General Information

  • ID:  hor005910
  • Uniprot ID:  P01021
  • Protein name:  Bradykinin-potentiating peptide B
  • Gene name:  NA
  • Organism:  Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)
  • Family:  Bradykinin-potentiating peptide family; Natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Gloydius (genus), Crotalinae (subfamily), Viperidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004857 enzyme inhibitor activity; GO:0005179 hormone activity; GO:0008191 metalloendopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QGLPPRPKIPP
  • Length:  11(85-95)
  • Propeptide:  MFVSRLAASGLLLLALMALSLDGKPVQQWSQGRPPGPPIPRLVVQQWSQGLPPGPPIPRLVVQQWSQGLPPGPPIPPLVVQQWSQGLPPRPKIPPLVVQQWSQGLPPRPKIPPLVVQKWDPPPVSPPLLLQPHESPAGGTTALREELSLGPEAASGPAAAGADGGRSGSKAPAALHRLSKSKGASATSASASRPMRDLRTDGKQARQNWARMVNPDHHAVGGCCCGGGGGGARRLKGLVKKGVAKGCFGLKLDRI
  • Signal peptide:  MFVSRLAASGLLLLALMALSLDG
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Blomhotin]: Inhibits the rabbit lung angiotensin-converting enzyme (ACE) (IC(50)=15 uM) (PubMed:10866809). Contracts the rat gastric fundus smooth muscle in a rapid and transient manner (PubMed:10519653, PubMed:10866809).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01021-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005910_AF2.pdbhor005910_ESM.pdb

Physical Information

Mass: 137800 Formula: C56H94N16O13
Absent amino acids: ACDEFHMNSTVWY Common amino acids: P
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -109.09 Boman Index: -1523
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 70.91
Instability Index: 6193.64 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10604536
  • Title:  Bradykinin-potentiating peptides and C-type natriuretic peptides from snake venom.
  • PubMed ID:  10519653
  • Title:  Blomhotin: a novel peptide with smooth muscle contractile activity identified in the venom of Agkistrodon halys blomhoffii.
  • PubMed ID:  4730295
  • Title:  Structure of potentiator A, one of the five br
  • PubMed ID:  4323853
  • Title:  
  • PubMed ID:  10866809
  • Title:  
  • PubMed ID:  11994001
  • Title:  
  • PubMed ID:  17714693
  • Title:  
  • PubMed ID:  23082758
  • Title:  
  • PubMed ID:  23056909
  • Title: